PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do028568.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bHLH
Protein Properties Length: 94aa    MW: 10241.6 Da    PI: 8.5297
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do028568.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH19.91.3e-0622611554
                HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
         HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                +i +  ++L+ llP+a   ++ ++  + +L++++ YI+sL
  Do028568.1 22 QISDLVAKLQALLPEARLRSNDRVPSVRVLQETCSYIRSL 61
                789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.556761IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.62E-82183IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.0E-62278IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSRSRA SSGGASGISD EQISDLVAKL QALLPEARLR SNDRVPSVRV LQETCSYIRS  60
LHREVDDLSD RLSELLATAD VSTAQAAVIR SLLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0938696e-88FP093869.1 Phyllostachys edulis cDNA clone: bphyst028g12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983143.16e-46PREDICTED: transcription factor ILI7
SwissprotA2Z7305e-44ILI7_ORYSI; Transcription factor ILI7
SwissprotQ338G65e-44ILI7_ORYSJ; Transcription factor ILI7
TrEMBLK4AH627e-46K4AH62_SETIT; Uncharacterized protein
STRINGSi038219m2e-45(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-32bHLH family protein